PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462941786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 280aa    MW: 31207.7 Da    PI: 6.313
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462941786genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.1e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt+Ed+llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
        462941786 17 KGPWTTQEDKLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding54.33.2e-1770114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
        462941786  70 RGKITPQEETIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4081264IPR017930Myb domain
SuperFamilySSF466891.47E-2915111IPR009057Homeodomain-like
SMARTSM007175.4E-161666IPR001005SANT/Myb domain
PfamPF002491.2E-171764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-231871IPR009057Homeodomain-like
CDDcd001679.73E-121964No hitNo description
PROSITE profilePS5129425.42765119IPR017930Myb domain
SMARTSM007177.9E-1669117IPR001005SANT/Myb domain
PfamPF002498.1E-1570114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2472117IPR009057Homeodomain-like
CDDcd001671.91E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEGQLSWGRQ EVDGWRKGPW TTQEDKLLVE HVRQHGEGRW NSVSKLTGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEETI IVQLHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIERARAR FLKQRREMQS QQQQQQQQQL QLVAKDDNEL DATRAAGTVT DDEDRGSAVV  180
DDNACAATTT TAAAAESGGH QAQHEEDLIV MHDAMDFMFP MSCALLLHGA GGQGVAGDGS  240
CCGSTSEEYG SSEVEDGATW GSLWNLEDVA VDGGACTLLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-132AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-129PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-129K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-66myb domain protein 79